viHumans
Reviewed
Epomops Franqueti (Franquet's Epauleted Fruit Bat) [TaxID: 77231]; Homo Sapiens (Human) [TaxID: 9606]; Myonycteris Torquata (Little Collared Fruit Bat) [TaxID: 77243]
GP[Gene ID: 911829 ]
Super small secreted glycoprotein (SsGP)
Zaire Ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola Virus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Ebolavirus> Zaire Ebolavirus> Ebola Virus> Zaire Ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola Virus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYE
AGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLR
EPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKKPH
298
Not Available
Not Available
09-02-2010
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
Secreted .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available