viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U19[Gene ID: 1497015 ]
Apoptosis inhibitor U19
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MAFTGDELARMLQFKDKMISSAGSALRFEKVVQEAMASGIVLQHITCIKVRICDNSDILSDRQLRCLLINGLYPFEGRMSMFGVTEEWEGASAAPERQVV
FLLSSTGQVLGYEDGVIFYLSPTFSDFWTTAMEFSCQNAILSNFIAQKSRDEYSDQFQKYFTRMRHTPISLTGVLPRRFQKVESGACVEEDARASMRPIQ
SDSFGAKGPFCWPTEELLQPSAKKDVGGTVCMALSCQEDNSARHCTIYGLTKTPGIKIMLSRHTQTDRSEAMCDAATQTEDVVDNSSETLFLGGNLVHQS
ILETEVQATAKNTFDVSDPRIDSVYDTTVVGAMATDDVGCKHVQGGASLAQEKPLKGYCIIATPSECKPNIHWLKSPENAVHESAAVLR
389
Not Available
Not Available
01-11-1999
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host apoptosis to facilitate efficient viral replication. Promotes stabilization and inactivation of host TP53 through interaction with host MDM2.
Not Available
GO:0030430  ;   GO:0039526  ;   GO:0042025  ;   GO:0071157  
Host cytoplasm HG98. Host nucleus . Note=localized in the host nucleus at early times postinfection and then increases in both nuclear and cytoplasmic compartments during the course of infection. HG98.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available