Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Phlebotominae (sandflies) [TaxID: 7198]
M[Gene ID: 14857909 ]
Matrix protein
Chandipura Virus (strain I653514) (CHPV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Chandipura Vesiculovirus> Chandipura Virus> Chandipura Virus (strain I653514) (CHPV)
Various pathway(s) in which protein is involved
Not Available
MQRLKKFIAKREKGDKGKMKWNSSMDYDSPPSYQDVRRGIFPTAPLFGMEDDMMEFTPSLGIQTLKLQYKCVVNINAINPFRDFREAISAMQFWEADYSG
YIGKKPFYRAIILHTARQLKTSNPGILDRGVVEYHATTQGRALVFHSLGPSPSMMFVPETFTREWNILTNKGTINVKIWLGETDTLSELEPILNPVNFRD
DREMIEGAAIMGLEIKKQKDNTWLISKSH
YIGKKPFYRAIILHTARQLKTSNPGILDRGVVEYHATTQGRALVFHSLGPSPSMMFVPETFTREWNILTNKGTINVKIWLGETDTLSELEPILNPVNFRD
DREMIEGAAIMGLEIKKQKDNTWLISKSH
229
Not Available
Not Available
01-11-1999
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shutoff presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).
Not Available
♦ Virion membrane
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein .
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein .
Not Available
MOTIF 30 33 PPXY motif.; MOTIF 42 45 PTAP/PSAP motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available