viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Phlebotominae (sandflies) [TaxID: 7198]
M[Gene ID: 14857909 ]
Matrix protein
Chandipura Virus (strain I653514) (CHPV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Chandipura Vesiculovirus> Chandipura Virus> Chandipura Virus (strain I653514) (CHPV)
Various pathway(s) in which protein is involved
Not Available
MQRLKKFIAKREKGDKGKMKWNSSMDYDSPPSYQDVRRGIFPTAPLFGMEDDMMEFTPSLGIQTLKLQYKCVVNINAINPFRDFREAISAMQFWEADYSG
YIGKKPFYRAIILHTARQLKTSNPGILDRGVVEYHATTQGRALVFHSLGPSPSMMFVPETFTREWNILTNKGTINVKIWLGETDTLSELEPILNPVNFRD
DREMIEGAAIMGLEIKKQKDNTWLISKSH
229
Not Available
Not Available
01-11-1999
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shutoff presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).
Not Available
GO:0019031  ;   GO:0033645  ;   GO:0039660  ;   GO:0039702  ;   GO:0055036  
♦ Virion membrane
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein .
Not Available
MOTIF 30 33 PPXY motif.; MOTIF 42 45 PTAP/PSAP motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available