viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U27[Gene ID: 1497029 ]
DNA polymerase processivity factor (Phosphoprotein P41) (PP41) (Polymerase accessory protein) (PAP)
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MERGSRDHHRDHRDHREHRELREPPTLAFHMKSWKTINKPLKAFTKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTEHFLTKTINNHIP
LFESFMNIISNPEVTKLYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDSGKSPLRIDLDHSTVSEVLKWLSPVTKTKRSGKSDAFMAHIIVQVNP
PTIKFVTEMNELEFSNSNKVIFYDVNNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKG
DRNHKNEDGSALASKQETQYKITNYMVPTKNGTAGSSLFNEKEDSESDDSMHFEYSSNPKRQRCVV
366
Not Available
Not Available
01-05-2000
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.
Not Available
GO:0003677  ;   GO:0006260  ;   GO:0019079  ;   GO:0030337  
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available