Reviewed
Homo Sapiens (Human) [TaxID: 9606]
NEC2 U34[Gene ID: 1497036 ]
Nuclear egress protein 2
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MANVLKEKMYDELLSATCRILKLGSHDYRMTERNLLSKNPKFPLCDIILKLDYAYNLEYLLSLWEHVTKQEPRFVFKNTGGAVSMSCYLHAPVKAEGHHA
VRECNILRVNECLTVRMSDIVAMKPSTFAVFTKCIIRRNRDETYVVEFVAFGPENESEYISLLKAIFLKKCSMGKQHLESNRFCQGLRRRSSHVLEKGQL
GSSGEIANKASAVVTSQESINQFYEKEKSFLSGVKFSRLSERHCRVAIVSICFLLALYFCYVLLKKTPTPASGPVV
VRECNILRVNECLTVRMSDIVAMKPSTFAVFTKCIIRRNRDETYVVEFVAFGPENESEYISLLKAIFLKKCSMGKQHLESNRFCQGLRRRSSHVLEKGQL
GSSGEIANKASAVVTSQESINQFYEKEKSFLSGVKFSRLSERHCRVAIVSICFLLALYFCYVLLKKTPTPASGPVV
276
Not Available
Not Available
01-05-2000
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.
Not Available
♦ Host nucleus inner membrane
♦ Single-pass membrane protein . Note=Localizes also at the transient membrane of perinuclear virions. .
♦ Single-pass membrane protein . Note=Localizes also at the transient membrane of perinuclear virions. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available