Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TRM2 U35[Gene ID: 1497037 ]
Tripartite terminase subunit 2
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MMDSSPEKTNLELLYEQVCEQGREFEVVFYPMLPRLYEMMLPSLEARLNFLSVGYRHVAFSRYVHGDVDCVHREVMAQKMVLLTSILSKLLNVNGILEHQ
EYLNTE
EYLNTE
106
Not Available
Not Available
01-05-2000
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.
Not Available
Host nucleus . Note=Found associated with the external surface of the viral capsid during assembly and DNA packaging, but seems absent in extracellular mature virions. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available