Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U65[Gene ID: 1497065 ]
Cytoplasmic envelopment protein 2
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MAISTFSIGDLGYLRNFLQNECNWFRICKKTFYREYRSVATSSPIFSLKNKPKKYCMHCEMVVLKRSHEFMFSLAVNGIHFGQFLTGIMKFKKKQVAEGL
CYYVLELGSISPVDLSFIPKYNSDCVTSMHCVTPELIYENCSIVCPEEASRLTVKGLGDNKLIPLGGCGVWCLKNGGDLYIYAFVLAYDLYVACYDKTIF
PSLAKIVFDMIACDSEDCVFCKDHNKHVSQAGHIVGCVSNQETCFCYTPCQKKMTDINNPELISLLCDQEINKIDIMYPEKKASLSLDINSYVHGYLGDE
PCALKCVNWMPIRISSALSRLIILSCPVCKRVVMD
CYYVLELGSISPVDLSFIPKYNSDCVTSMHCVTPELIYENCSIVCPEEASRLTVKGLGDNKLIPLGGCGVWCLKNGGDLYIYAFVLAYDLYVACYDKTIF
PSLAKIVFDMIACDSEDCVFCKDHNKHVSQAGHIVGCVSNQETCFCYTPCQKKMTDINNPELISLLCDQEINKIDIMYPEKKASLSLDINSYVHGYLGDE
PCALKCVNWMPIRISSALSRLIILSCPVCKRVVMD
335
Not Available
Not Available
01-05-2000
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a critical role in cytoplasmic virus egress. Participates in the final step of tegumentation and envelope acquisition within the host cytoplasm by directly interacting with the capsid. Upon virion binding to target cell, a signaling cascade is triggered to disrupt the interaction with the capsid, thereby preparing capsid uncoating.
Not Available
Virion tegument . Host cytoplasm . Host nucleus . Note=Localizes in the host nucleus up to 18 hours postinfection, but at later times localizes to punctate, cytoplasmic structures. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available