viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U85[Gene ID: 1497085 ]
Putative OX-2 membrane glycoprotein homolog (Protein U85)
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MSPLMLRLLPLLCIIISAHFVPRPETSPSLVYEIGSTVTFHCRLNTTTNIQSVSWYNKSRLISNHEIQNMDNLSFTDDGYVFIHELNKINNLDVDSKLYF
HIKHDRTTSLLKIKARSAYDATCLTCTFTVDNEKTSATSCLKLIMKPIVVLYFRYLNNFLDVTCTVTSYPKPNVVIKFLGEVYKRDIPMVRQNENGSSTV
SVSFTFKRRTKLEFVGKTISCLASSWFTNQKASALVTSGEHTVQNHDEYSKEAVKGSNSDETVFTWIVPLILILIISVMVLLISMCIVAFKS
292
Not Available
Not Available
01-05-2000
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
GO:0016021  ;   GO:0033644  ;   GO:0043031  ;   GO:0050776  
♦ Host membrane
♦ Single-pass membrane protein.
♦DOMAIN 24 136 Ig-like V-type.
♦ DOMAIN 147 237 Ig-like C2-type.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available