viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 1 (NSP1) (NCVP2) (Non-structural RNA-binding protein 53) (NS53)
Rotavirus C (isolate RVC/Human/United Kingdom/Bristol/1989) (RV-C)
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus C> Rotavirus C (isolate RVC/Human/United Kingdom/Bristol/1989) (RV-C)
KP988013.1 ;  KP988014.1 ;  KP988015.1 ;  KP988016.1 ;  KP988017.1 ;  KP988018.1 ;  KP988019.1 ;  
KP988020.1 ;  KP988021.1 ;  KP988022.1 ;  KP988023.1 
Various pathway(s) in which protein is involved
Not Available
MANSFREMLYWYRKIIDRKLPCVNVNIWRREIAYKANGICLNCLNECKVCPCDYCGIRHKCENCLNSDCFMNTNNEFNSHRWITFDEEPSQMVLFEYWIM
YKDYFLSKFNYNYKAQLKILNMNKNRRFHINESKKKALSVPITSQYLKFKFNNKIYIMFGTFLTSKIQPWIQLKSLKVGYIQSLNVDRCAKLIATKGMFA
TNSFKSSCITEINARRPISECDYLIEACLCNENNEWKFSAVMGRDKIPVTKSLAMKYFCKNINTELFYYGHSKCHVVSECPRWNQQLRVLNASTLNIIFR
RQFMNEVVEWFENFTQLTGMHYDFIKTCVYNKVIISHFRKEIEDYINSGKKISLSSVIPDGHALYTNIDILRISLMLAIDVALNRIESQQMDVL
394
Not Available
Not Available
01-05-2000
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host innate immunity by inducing the degradation of key host factors required to activate interferon production such as IRF3, IRF5 or IRF7. Associates with components of cullin RING ligases (CRLs) including CUL1 or CUL3, which are essential multisubunit ubiquitination complexes, to modulate their activities.
Not Available
GO:0003723  ;   GO:0030430  ;   GO:0039548  ;   GO:0039557  ;   GO:0044163  ;  
GO:0046872  
Host cytoplasm, host cytoskeleton .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available