viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
P/V
Non-structural protein V
Measles Virus (strain Edmonston-AIK-C Vaccine) (MeV) (Subacute Sclerose Panencephalitis Virus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Morbillivirus> Measles Morbillivirus> Measles Virus (strain Edmonston-AIK-C Vaccine) (MeV) (Subacute Sclerose Panencephalitis Virus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEISDNPGQERATCREEKAGSSGLSKPCLSAIGSTEGGAPRIRGQGPGESDDDAETLGIPPRNL
QASSTGLQCYYVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDNESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLRLQSRG
NNFPKLGKTLNVPPPPDPGRASTSGTPIKKGHRREISLIWNGDRVFIDRWCNPMCSKVTLGTIRARCTCGECPRVCEQCRTDTGVDTRIWYHNLPEIPE
299
Not Available
Not Available
01-10-2000
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an essential role in the inhibition of host immune response. Prevents the establishment of cellular antiviral state by blocking interferon-alpha/beta (IFN-alpha/beta) production and signaling pathway. Interacts with host IFIH1/MDA5 and DHX58/LGP2 to inhibit the transduction pathway involved in the activation of IFN-beta promoter, thus protecting the virus against cell antiviral state. Blocks the type I interferon signaling pathway by interacting with host TYK2 and thereby inhibiting downstream STAT1 and STAT2 phosphorylation. Moderately affects the type II interferon signaling (By similarity).
Not Available
GO:0030430  ;   GO:0039502  ;   GO:0039554  ;   GO:0039557  ;   GO:0039563  ;  
GO:0039564  ;   GO:0039574  ;   GO:0046872  
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available