Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
NS
Non-structural protein 1 (NS1) (NS1A)
Influenza C Virus (strain C/Hyogo/1/1983)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Gammainfluenzavirus> Influenza C Virus> Influenza C Virus (strain C/Hyogo/1/1983)
NC_006307.2 ; AB126193.2 ; NC_006308.2 ; AB126196.2 ; NC_006309.2 ; AB126191.2 ; NC_006310.2 ;
AB283001.1 ; NC_006311.1 ; AB126195.1 ; NC_006312.2 ; AB126191.2 ; NC_006306.2 ; AB283001.1
AB283001.1 ; NC_006311.1 ; AB126195.1 ; NC_006312.2 ; AB126191.2 ; NC_006306.2 ; AB283001.1
Various pathway(s) in which protein is involved
Not Available
Not Available
MSDKTVKSTNLMAFIATKMLERQEDLDTCTEMQVEKMKTSTKARLRTESSFAPRTWEDAIKDGELLFNGTILQAESPTMTPASVEMKGKKLPIDFAPSNI
APIGQNPIYLSPCIPNFDGNVWEATMYHHRGATLTKTMNCNCFQRTIWCHPNPSRMRLSYAFVLYCRNTKKICGYLIARQVAGIETGIRKCFRCIKSGFV
MATDEISLTILQSIKSGAQLDPYWGNETPDIDKTEAYMLSLREAGP
APIGQNPIYLSPCIPNFDGNVWEATMYHHRGATLTKTMNCNCFQRTIWCHPNPSRMRLSYAFVLYCRNTKKICGYLIARQVAGIETGIRKCFRCIKSGFV
MATDEISLTILQSIKSGAQLDPYWGNETPDIDKTEAYMLSLREAGP
246
Not Available
Not Available
01-03-2001
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Prevents the establishment of the cellular antiviral state initiated by host DDX58, which normally triggers the antiviral transduction signal that leads to the activation of type I IFN genes by transcription factors IRF3 and IRF7. Participates also in the upregulation of the splicing of viral mRNAs.
Not Available
Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available