Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Pan Troglodytes (Chimpanzee) [TaxID: 9598]
S
Large envelope protein (L glycoprotein) (L-HBsAg) (LHB) (Large S protein) (Large surface protein) (Major surface antigen)
Hepatitis B Virus Genotype C (isolate Vietnam/3270/2000) (HBV-C)
Viruses> Retro-transcribing Viruses> Hepadnaviridae> Orthohepadnavirus (mammalian Hepatitis B-type Viruses)> Hepatitis B Virus (HBV)> HBV Genotype C> Hepatitis B Virus Genotype C (isolate Vietnam/3270/2000) (HBV-C)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPATPPPASTNRQ
SGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPVPKMENTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTT
PAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
SGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPVPKMENTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTT
PAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
400
VAR_SEQ 1 174 Missing (in isoform S) ; VAR_SEQ 1 119 Missing (in isoform M)
Not Available
01-03-2001
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. This attachment induces virion internalization predominantly through caveolin-mediated endocytosis. The large envelope protein also assures fusion between virion membrane and endosomal membrane. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein.
♦ The middle envelope protein plays an important role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid independent way. In this process the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm of diameter that do not contain a nucleocapsid.
♦ The middle envelope protein plays an important role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid independent way. In this process the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm of diameter that do not contain a nucleocapsid.
Not Available
Virion membrane .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available