viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Simiiformes [TaxID: 314293]
RPO7 55R[Gene ID: 918646 ]
DNA-directed RNA polymerase 7 kDa subunit (EC 2.7.7.6)
Yaba-like Disease Virus (YLDV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Yatapoxvirus> Tanapox Virus> Yaba-like Disease Virus (YLDV)
Various pathway(s) in which protein is involved
Not Available
MVFQLICSTCGRDISEERYYLLIKELSLKKVLEGVKNNCCRLKLSTQIEPQRNLTVQPLIDIN
63
Not Available
Not Available
01-03-2001
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Part of the DNA-dependent RNA polymerase which catalyzes the transcription of viral DNA into RNA using the four ribonucleoside triphosphates as substrates. Responsible for the transcription of early, intermediate and late genes. DNA-dependent RNA polymerase associates with the early transcription factor (ETF) thereby allowing the early genes transcription. Late transcription, and probably also intermediate transcription, require newly synthesized RNA polymerase (By similarity).
2.7.7.6  
GO:0003677  ;   GO:0003899  ;   GO:0006351  ;   GO:0019012  
Virion . Note=All the enzymes and other proteins required to synthesize early mRNAs are packaged within the virion core along with the DNA genome. This is necessary because viral early mRNAs are synthesized within minutes after virus entry into the cell and are extruded through pores in the core particle (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available