Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Simiiformes [TaxID: 314293]
67R[Gene ID: 918711 ]
Probable host range protein 2
Yaba-like Disease Virus (YLDV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Yatapoxvirus> Tanapox Virus> Yaba-like Disease Virus (YLDV)
Various pathway(s) in which protein is involved
Not Available
MGITHELDIFVTNEDLALKNVELFKGNSYGCFINLKVKEEKKFNIIFVLKPDWSEVDKVKPIRMIVNNNSVDVEKVSESLYQVVYSASFSINSDSYVKVF
SDNPDKYKHMYPTVTINVPKKKFKVVDQGNTYMFIQSPIDDCDKEQFLKNEFEYYDEENDFDDYEEYVKNRNDSFDDY
SDNPDKYKHMYPTVTINVPKKKFKVVDQGNTYMFIQSPIDDCDKEQFLKNEFEYYDEENDFDDYEEYVKNRNDSFDDY
178
Not Available
Not Available
01-03-2001
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays a role for multiplication of the virus in different cell types.
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available