viHumans
Reviewed
Cynopterus Brachyotis (Lesser Short-nosed Fruit Bat) (Pachysoma Brachyotis) [TaxID: 58060]; Eonycteris Spelaea (Lesser Dawn Bat) (Macroglossus Spelaeus) [TaxID: 58065]; Homo Sapiens (Human) [TaxID: 9606]; Pteropus Hypomelanus (Island Flying Fox) (Variable Flying Fox) [TaxID: 9405]; Pteropus Vampyrus (Large Flying Fox) [TaxID: 132908]; Scotophilus Kuhlii (Lesser Asiatic Yellow Bat) [TaxID: 153297]; Sus Scrofa (Pig) [TaxID: 9823]
P/V/C[Gene ID: 920952 ]
Protein C
Nipah Virus
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Henipavirus> Nipah Virus
Various pathway(s) in which protein is involved
Not Available
Not Available
MMASILLTLFRRTKKKYRRHTDDQVFNNPASKIKQKPGKIFCSAPVENLNKLRGECLRMMEMLKEETWRIYPVLLPQMELLERECRTPVTGQKVQMTYNW
TQWLQTLYTMIMEENVPDMDLLQALREGGVITHQEQTMGMYVLYLMQRCCPMLPKLQFLKKIGKLI
166
Not Available
Not Available
01-06-2001
Predicted
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May counteract the cellular interferon antiviral system.
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available