viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MC005L[Gene ID: 1487026 ]
Protein MC005
Molluscum Contagiosum Virus Subtype 1 (MOCV) (MCVI)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Molluscipoxvirus> Molluscum Contagiosum Virus> Molluscum Contagiosum Virus Subtype 1 (MOCV) (MCVI)
Various pathway(s) in which protein is involved
Not Available
MCLVAPMQCGCASCVRILDALLSAMEALVQMRLLSEEEKTSCASQFLELAIFAVENCRGGRQALLQARGEPASLGEVAGKGPAAD
85
Not Available
Not Available
01-02-1997
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of the host NF-kappa-B pathway by preventing ubiquitin binding-dependent regulation of host IKBKB activation by IKBKG/NEMO.
Not Available
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available