Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Macaca Fascicularis (Crab-eating Macaque) (Cynomolgus Monkey) [TaxID: 9541]; Pteropodinae [TaxID: 77225]; Sus Scrofa (Pig) [TaxID: 9823]
VP35
Polymerase cofactor VP35
Reston Ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola Virus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Ebolavirus> Reston Ebolavirus> Reston Ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MYNDKLKICSGPETTGWISEQLMTGKIPVTDIFIDIDNKPDQMEVRLKPSSRSSTRTCTSSSQTEVNYVPLLKKVEDTLTMLVSATSRQNAAIEALENRL
STLESSLKPIQDMGKVISSLNRSCAEMVAKYDLLVMTTGRATSTAAAVDAYWKEHKQPPPGPALYEENALKGKIDDPNSYVPDAVQEAYKNLDSTSTLTE
ENFGKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPTIHIRSRGDIPRACQKSL
RPAPPSPKIDRGWVCLFKMQDGKTLGLKI
STLESSLKPIQDMGKVISSLNRSCAEMVAKYDLLVMTTGRATSTAAAVDAYWKEHKQPPPGPALYEENALKGKIDDPNSYVPDAVQEAYKNLDSTSTLTE
ENFGKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPTIHIRSRGDIPRACQKSL
RPAPPSPKIDRGWVCLFKMQDGKTLGLKI
329
Not Available
Not Available
01-12-2001
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Acts as a polymerase cofactor in the RNA polymerase transcription and replication complex. Prevents establishment of cellular antiviral state by blocking virus-induced phosphorylation and activation of interferon regulatory factor 3 (IRF3), a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition host IKBKE and TBK1 producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR (By similarity).
Not Available
GO:0003723 ; GO:0006351 ; GO:0019012 ; GO:0030430 ; GO:0039557 ;
GO:0039722 ; GO:0039723 ; GO:0039724
GO:0039722 ; GO:0039723 ; GO:0039724
Virion. Host cytoplasm .
DOMAIN 204 329 VP35 IID.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available