viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Macaca Fascicularis (Crab-eating Macaque) (Cynomolgus Monkey) [TaxID: 9541]; Pteropodinae [TaxID: 77225]; Sus Scrofa (Pig) [TaxID: 9823]
VP30
Minor nucleoprotein VP30 (Transcription activator VP30)
Reston Ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola Virus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Ebolavirus> Reston Ebolavirus> Reston Ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MEHSRERGRSSNMRHNSREPYENPSRSRSLSRDPNQVDRRQPRSASQIRVPNLFHRKKTDALIVPPAPKDICPTLKKGFLCDSKFCKKDHQLDSLNDHEL
LLLIARRTCGIIESNSQITSPKDMRLANPTAEDFSQGNSPKLTLAVLLQIAEHWATRDLRQIEDSKLRALLTLCAVLTRKFSKSQLGLLCETHLRHEGLG
QDQADSVLEVYQRLHSDKGGNFEAALWQQWDRQSLIMFISAFLNIALQTPCESSSVVVSGLATLYPAQDNSTPSEATNDTTWSSTVE
287
Not Available
Not Available
01-12-2001
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Acts as a transcription anti-termination factor immediately after transcription initiation, but does not affect transcription elongation. This function has been found to be dependent on the formation of an RNA stem-loop at the transcription start site of the first gene. Binds to RNA (By similarity).
Not Available
GO:0003723  ;   GO:0006351  ;   GO:0019013  ;   GO:0030430  ;   GO:0046872  
Virion. Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available