Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Early 3 Conserved Region 1-alpha protein (E3 CR1-alpha) (Early 3 6.7K protein) (E3-6.7k)
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSNSSNSTSLSNFSGIGVGVILTLVILFILILALLCLRVAACCTHVCTYCQLFKRWGQHPR
61
Not Available
Not Available
01-12-2001
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Prevents infected cell apoptosis induced by the host immune system. May act by downregulating host TRAIL receptors. May act in complex with E3 RID alpha and beta. May play a role on cellular apoptosis regulation in the ER.
Not Available
♦ Host endoplasmic reticulum membrane
♦ Single-pass membrane protein. Host cell membrane
♦ Single-pass membrane protein.
♦ Single-pass membrane protein. Host cell membrane
♦ Single-pass membrane protein.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available