viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
N[Gene ID: 3077251 ]
Nucleoprotein (EC 3.1.13.-) (Nucleocapsid protein) (Protein N)
Sabia Mammarenavirus (isolate Human/Brasil/SPH114202/1990) (SABV) (Sabi Mammarenavirus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Arenaviridae> Mammarenavirus> Sabia Mammarenavirus (isolate Human/Brasil/SPH114202/1990) (SABV) (Sabi Mammarenavirus)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSNSKEIPSFRWTQSLRRGLSEFTTPVKTDVLRDAKMILDGLDFNQVSLVQRILRKSKRNDGDLDKLRDLNKEVDNLMSMKSSQRDTILKLGDLNKSELM
DLASDLEKLKRKVGQTERSASGGVYLGNLSQSQLTKRSDLLRKLGFQQQQVRSPGVVRIWDVADPNRLNNQFGSVPALTIACMTKQSDNTMGDVVQALTS
LGLLYTVKFPNLIDLEKLTAEHDCLQIVTKDESGLNISGYNYSLSAAVKAGATLLDGGNMLETIRITPDNFSQIIKTTLSIKKKEGMFVDEKPGNRNPYE
NLLYKICLSGEGWPYIGSRSQIKGRSWENTTVDLSTKPQQGPRTPEKAGQNIRLSHLTELQESVVREAMGKIDPTLTTWIDIEGTSNDPVELALYQPDTG
NYILCYRKPHDEKGFKNGSRHSHGMLLKDLESAQPGLLSYVIGLLPQNMVLTTQGSDDIRRLVDTHGRKDLKIVDIKLASEQARKFEEPIWSDFGHLCKK
HNGVIVPKKKKDKDIPQSSEPHCALLDCLMFQSAIAGQPPQTKLEGLLPDALLFTLEAAFTI
562
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of host IRF3, a protein involved in interferon activation pathway, leading to the inhibition of interferon-beta and IRF3-dependent promoters activation. Encodes also a functional 3'-5' exoribonuclease that degrades preferentially dsRNA substrates and therby participates in the suppression of interferon induction.
3.1.13.-  
GO:0003723  ;   GO:0016787  ;   GO:0019013  ;   GO:0019029  ;   GO:0030430  ;  
GO:0039689  ;   GO:0039696  ;   GO:0039724  ;   GO:0046872  
Virion . Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available