viHumans
Reviewed
Cynomys Gunnisoni (Gunnison's Prairie Dog) [TaxID: 45479]; Cynomys Leucurus (White-tailed Prairie Dog) [TaxID: 99825]; Cynomys Ludovicianus (Black-tailed Prairie Dog) [TaxID: 45480]; Cynomys Mexicanus (Mexican Prairie Dog) [TaxID: 99826]; Cynomys Parvidens (Utah Prairie Dog) [TaxID: 99827]; Gliridae (dormice) [TaxID: 30650]; Heliosciurus Ruwenzorii (Ruwenzori Sun Squirrel) [TaxID: 226685]; Homo Sapiens (Human) [TaxID: 9606]; Mus Musculus (Mouse) [TaxID: 10090]
A30L[Gene ID: 928965 ]
Envelope protein A28 homolog (Protein A30)
Monkeypox Virus (strain Zaire-96-I-16) (MPX)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Monkeypox Virus> Monkeypox Virus (strain Zaire-96-I-16) (MPX)
Various pathway(s) in which protein is involved
Not Available
MNSLSIFFIVVATAAVCLLFIQSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNT
RSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
146
Not Available
Not Available
01-03-2002
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope protein required for virus entry into host cell and for cell-cell fusion (syncytium formation).
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0039663  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type II membrane protein . Note=Component of the intracellular mature virion (IMV) membrane. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available