viHumans
Reviewed
Bos Taurus (Bovine) [TaxID: 9913]; Felis Catus (Cat) (Felis Silvestris Catus) [TaxID: 9685]; Homo Sapiens (Human) [TaxID: 9606]; Loxodonta Africana (African Elephant) [TaxID: 9785]; Microtus Agrestis (Short-tailed Field Vole) [TaxID: 29092]; Mus Musculus (Mouse) [TaxID: 10090]; Myodes Glareolus (Bank Vole) (Clethrionomys Glareolus) [TaxID: 447135]
CPXV163[Gene ID: 1486042 ]
Envelope protein A28 homolog (Protein CPXV163)
Cowpox Virus (strain Brighton Red) (CPV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Cowpox Virus (CPV)> Cowpox Virus (strain Brighton Red) (CPV)
 
Various pathway(s) in which protein is involved
Not Available
MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVTYPGNGFVSASVFGFQAEVGPNNT
RSIRKFNTMQQCIDFTFSDVINIDIYNPCVAPNINNAECQFLKSVL
146
Not Available
Not Available
01-06-2002
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope protein required for virus entry into host cell and for cell-cell fusion (syncytium formation).
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0039663  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type II membrane protein . Note=Component of the intracellular mature virion (IMV) membrane. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available