viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Pteropus Alecto (Black Flying Fox) [TaxID: 9402]; Pteropus Conspicillatus (Spectacled Flying Fox) [TaxID: 328804]; Pteropus Poliocephalus (Grey-headed Flying Fox) [TaxID: 9403]; Pteropus Scapulatus (Little Red Flying Fox) [TaxID: 94117]; Saccolaimus [TaxID: 446909]
M
Matrix protein (Phosphoprotein M2)
Australian Bat Lyssavirus (isolate Human/AUS/1998) (ABLV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Lyssavirus> Australian Bat Lyssavirus> Australian Bat Lyssavirus (isolate Human/AUS/1998) (ABLV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MNFLRKIVRNCKDEDDQKPPLVSAPPDDDDLWLPPPEYVPLTEITGKRNMRNFCINGEVKVCSPNGYSFRILRHILKSFDEIYSGNHRMIGLVKVVIGLA
LSGAPVPEGMNWVYKLRRTLIFQWAESRGPLDGEELEYSQEITWDDDSEFIGLQIRVSARQCHIQGRIWCINMNSRACQLWSDMSLKTQQSEEDKNSSLL
LE
202
Not Available
Not Available
11-11-2015
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity).
Not Available
GO:0019031  ;   GO:0033645  ;   GO:0039660  ;   GO:0039702  ;   GO:0055036  
♦ Virion membrane
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein .
Not Available
MOTIF 45 48 PPXY motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available