Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Pteropus Alecto (Black Flying Fox) [TaxID: 9402]; Pteropus Conspicillatus (Spectacled Flying Fox) [TaxID: 328804]; Pteropus Poliocephalus (Grey-headed Flying Fox) [TaxID: 9403]; Pteropus Scapulatus (Little Red Flying Fox) [TaxID: 94117]; Saccolaimus [TaxID: 446909]
M
Matrix protein (Phosphoprotein M2)
Australian Bat Lyssavirus (isolate Human/AUS/1998) (ABLV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Lyssavirus> Australian Bat Lyssavirus> Australian Bat Lyssavirus (isolate Human/AUS/1998) (ABLV)
12083841 ;
Various pathway(s) in which protein is involved
Not Available
Not Available
MNFLRKIVRNCKDEDDQKPPLVSAPPDDDDLWLPPPEYVPLTEITGKRNMRNFCINGEVKVCSPNGYSFRILRHILKSFDEIYSGNHRMIGLVKVVIGLA
LSGAPVPEGMNWVYKLRRTLIFQWAESRGPLDGEELEYSQEITWDDDSEFIGLQIRVSARQCHIQGRIWCINMNSRACQLWSDMSLKTQQSEEDKNSSLL
LE
LSGAPVPEGMNWVYKLRRTLIFQWAESRGPLDGEELEYSQEITWDDDSEFIGLQIRVSARQCHIQGRIWCINMNSRACQLWSDMSLKTQQSEEDKNSSLL
LE
202
Not Available
Not Available
11-11-2015
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity).
Not Available
♦ Virion membrane
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein .
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein .
Not Available
MOTIF 45 48 PPXY motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available