viHumans
Reviewed
Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Culicoides [TaxID: 58271]; Equus Asinus (Donkey) (Equus Africanus Asinus) [TaxID: 9793]; Equus Caballus (Horse) [TaxID: 9796]; Homo Sapiens (Human) [TaxID: 9606]; Lutzomyia [TaxID: 252607]; Musca Domestica (House Fly) [TaxID: 7370]; Simuliidae (black Flies) [TaxID: 7190]; Sus Scrofa (Pig) [TaxID: 9823]
M
Matrix protein
Vesicular Stomatitis Indiana Virus (strain 98COE North America) (VSIV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Indiana Vesiculovirus> Vesicular Stomatitis Indiana Virus> Vesicular Stomatitis Indiana Virus (strain 98COE North America) (VSIV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAG
KRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSD
FREKALMFGLIVEKKASGAWILDSVSHFK
229
VAR_SEQ 1 50 Missing (in isoform M3) ; VAR_SEQ 1 32 Missing (in isoform M2)
Not Available
01-03-2003
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shutoff presumably inhibits interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).
Not Available
GO:0019031  ;   GO:0039522  ;   GO:0039657  ;   GO:0039660  ;   GO:0039702  ;  
GO:0044200  ;   GO:0055036  
♦ Virion membrane
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein. Host nucleus membrane
♦ Peripheral membrane protein .
Not Available
MOTIF 24 27 PPXY motif.; MOTIF 37 40 PTAP/PSAP motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available