Reviewed
Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Culicoides [TaxID: 58271]; Equus Asinus (Donkey) (Equus Africanus Asinus) [TaxID: 9793]; Equus Caballus (Horse) [TaxID: 9796]; Homo Sapiens (Human) [TaxID: 9606]; Lutzomyia [TaxID: 252607]; Musca Domestica (House Fly) [TaxID: 7370]; Simuliidae (black Flies) [TaxID: 7190]; Sus Scrofa (Pig) [TaxID: 9823]
M
Matrix protein
Vesicular Stomatitis Indiana Virus (strain 98COE North America) (VSIV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Indiana Vesiculovirus> Vesicular Stomatitis Indiana Virus> Vesicular Stomatitis Indiana Virus (strain 98COE North America) (VSIV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAG
KRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSD
FREKALMFGLIVEKKASGAWILDSVSHFK
KRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSD
FREKALMFGLIVEKKASGAWILDSVSHFK
229
VAR_SEQ 1 50 Missing (in isoform M3) ; VAR_SEQ 1 32 Missing (in isoform M2)
Not Available
01-03-2003
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shutoff presumably inhibits interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).
Not Available
♦ Virion membrane
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein. Host nucleus membrane
♦ Peripheral membrane protein .
♦ Peripheral membrane protein. Host endomembrane system
♦ Peripheral membrane protein. Host nucleus membrane
♦ Peripheral membrane protein .
Not Available
MOTIF 24 27 PPXY motif.; MOTIF 37 40 PTAP/PSAP motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available