viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L2[Gene ID: 2715931 ]
Pre-histone-like nucleoprotein (Pre-core protein VII) (pVII) [Cleaved into: Histone-like nucleoprotein (NP) (Core protein VII)]
Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus F> Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Various pathway(s) in which protein is involved
Not Available
MSILISPDNNTGWGLCSAGMYGGAKRRSSQHPVRVRGHYRAPWGAYTRGVISRRTTVDDVIDSVVADAQRYTRPVATSTVDSVIDSVVANARRYAQRKRR
LQRRRRRPTAAMTAARAVLRRAQRIGRRAMRRAAASASAGRARRQAARQAAAAIASMAQPRRGNIYWVRDASGVRVPVRSRPPRS
185
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host immune response within the nucleus. Interacts with cellular nucleosomes and immobilizes the host immune danger signal HMGB1 on chromatin. In turn, prevents HMGB1 release out of the cell and thus decreases inflammation. Plays also a role in the wrapping and condensation of the viral DNA. May also promote viral genome import into the nucleus.
Not Available
GO:0003677  ;   GO:0019028  ;   GO:0044196  ;   GO:0046718  ;   GO:0075732  
♦ Histone-like nucleoprotein: Virion . Note=Located inside the capsid in association with the viral DNA (core). Present in about 1070 copies per virion. .
♦ Pre-histone-like nucleoprotein: Host nucleus, host nucleolus .
Not Available
MOTIF 175 185 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available