Reviewed
Homo Sapiens (Human) [TaxID: 9606]
HA MVA165R ACAM3000_MVA_165 A56R
Protein A56 (Hemagglutinin)
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MTRLPILLLLISLVYATPFPQTSKKIGDDATLSCNRNNTNDYVVMSAWYKEPNSIILLAAKSDVLYFDNYTKDKISYDSPYDDLVTTITIKSLTARDAGT
YVCAFFMTSPTNDTDKVDYEEYSTELIVNTDSESTIDIILSGSTHSPETSSEKPDYIDNSNCSSVFEIATPEPITDNVEDHTDTVTYTSDSINTVSASSG
ESTTDETPEPITDKEEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDTYNDNDTVPSTTVGGSTTSISNYKTKDFVEIFGITALIILSAVAIFCITYY
IYNKRSRKYKTENKV
YVCAFFMTSPTNDTDKVDYEEYSTELIVNTDSESTIDIILSGSTHSPETSSEKPDYIDNSNCSSVFEIATPEPITDNVEDHTDTVTYTSDSINTVSASSG
ESTTDETPEPITDKEEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDTYNDNDTVPSTTVGGSTTSISNYKTKDFVEIFGITALIILSAVAIFCITYY
IYNKRSRKYKTENKV
315
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Prevents cell to cell fusion by interacting with and directing the viral K2 protein on the host plasma membrane. The A56-K2 complex associates with components of the entry fusion complex (EFC) presumably to avoid superinfection and syncytium formation. Via its interaction with C3/VCP protein, protects the infected cell and probably also the extracellular enveloped virus from complement attack (By similarity).
Not Available
♦ Virion membrane
♦ Single-pass type I membrane protein . Host membrane
♦ Single-pass type I membrane protein. Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Component of the outermost membrane of EEV (By similarity). .
♦ Single-pass type I membrane protein . Host membrane
♦ Single-pass type I membrane protein. Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Component of the outermost membrane of EEV (By similarity). .
DOMAIN 17 121 Ig-like V-type.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available