viHumans
Reviewed
Canis Lupus Familiaris (Dog) (Canis Familiaris) [TaxID: 9615]; Homo Sapiens (Human) [TaxID: 9606]
NP N[Gene ID: 3160799 ]
Nucleoprotein (Nucleocapsid protein) (NP) (Protein N)
Parainfluenza Virus 5 (strain W3) (PIV5) (Simian Virus 5)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Rubulavirus> Mammalian Rubulavirus 5> Parainfluenza Virus 5 (strain W3) (PIV5) (Simian Virus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSSVLKAYERFTLTQELQDQSEEGTIPPTTLKPVIRVFILTSNNPELRSRLLLFCLRIVLSNGARDSHRFGALLTMFSLPSATMLNHVKLADQSPEADIE
RVEIDGFEEGSFRLIPNARSGMSRGEINAYAALAEDLPDTLNHATPFVDSEVEGTAWDEIETFLDMCYSVLMQAWIVTCKCMTAPDQPAASIEKRLQKYR
QQGRINPRYLLQPEARRIIQNVIRKGMVVRHFLTFELQLARAQSLVSNRYYAMVGDVGKYIENCGMGGFFLTLKYALGTRWPTLALAAFSGELTKLKSLM
ALYQTLGEQARYLALLESPHLMDFAAANYPLLYSYAMGIGYVLDVNMRNYAFSRSYMNKTYFQLGMETARKQQGAVDMRMAEDLGLTQAERTEMANTLAK
LTTANRGADTRGGVNPFSSVTGTTQVPAAATGDTLESYMAADRLRQRYADAGTHDDEMPPLEEEEEDDTSAGPRTGPTLEQVALDIQNAAVGAPIHTDDL
NAALGDLDI
509
Not Available
Not Available
01-11-1996
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Encapsidates the genome, protecting it from nucleases. The nucleocapsid (NC) has a helical structure. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases.
Not Available
GO:0003723  ;   GO:0005198  ;   GO:0019013  ;   GO:0019029  ;   GO:0030430  
Virion . Host cytoplasm .
Not Available
Not Available
X-ray crystallography (2)
4XJN  5WKN  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available