Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Rattus Norvegicus (Rat) [TaxID: 10116]
Not Available
Non-structural protein 1, peptide 1 (NSP1 peptide 1) (NSP1-1)
Rotavirus B (isolate RVB/Rat/United States/IDIR/1984/G1P[X]) (RV-B) (Rotavirus B (isolate Infectious Diarrhea Of Infant Rats))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus B> Unclassified Rotavirus B> Rotavirus B (isolate RVB/Rat/United States/IDIR/1984/G1P[X]) (RV-B) (Rotavirus B (isolate Infectious Diarrhea Of Infant Rats))
KU562873.1 ; KU562874.1 ; KU562875.1 ; KU562876.1 ; KU562877.1 ; KU562878.1 ; KU562879.1 ;
KU562880.1 ; KU562881.1 ; KU562882.1 ; KU562883.1
KU562880.1 ; KU562881.1 ; KU562882.1 ; KU562883.1
Various pathway(s) in which protein is involved
Not Available
Not Available
MGNRQSSAQLNSHLTQISSQHSNLYISDSKTSTFQTQHIILVAGVGIIVALFILLVCSCVLNCYLCNKFKRENGIQSISKRSLRQSRPSPNLYVQPVMQS
NPFIKEARESICSEV
NPFIKEARESICSEV
115
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Not Available
Not Available
♦ Host membrane
♦ Single-pass membrane protein .
♦ Single-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available