viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Rattus Norvegicus (Rat) [TaxID: 10116]
Not Available
Non-structural protein 1, peptide 1 (NSP1 peptide 1) (NSP1-1)
Rotavirus B (isolate RVB/Rat/United States/IDIR/1984/G1P[X]) (RV-B) (Rotavirus B (isolate Infectious Diarrhea Of Infant Rats))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus B> Unclassified Rotavirus B> Rotavirus B (isolate RVB/Rat/United States/IDIR/1984/G1P[X]) (RV-B) (Rotavirus B (isolate Infectious Diarrhea Of Infant Rats))
KU562873.1 ;  KU562874.1 ;  KU562875.1 ;  KU562876.1 ;  KU562877.1 ;  KU562878.1 ;  KU562879.1 ;  
KU562880.1 ;  KU562881.1 ;  KU562882.1 ;  KU562883.1 
Various pathway(s) in which protein is involved
Not Available
Not Available
MGNRQSSAQLNSHLTQISSQHSNLYISDSKTSTFQTQHIILVAGVGIIVALFILLVCSCVLNCYLCNKFKRENGIQSISKRSLRQSRPSPNLYVQPVMQS
NPFIKEARESICSEV
115
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
♦ Host membrane
♦ Single-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available