viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
C5L
Apoptosis regulator Bcl-2 homolog (vBcl-2)
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MYNSMLPMFMCNNIVDDIDDIDDIDDIDDIDDIDDIDDKASNNDDHNYVYPLPENMVYRFNKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLPTK
TRSYIDIINMYCDKVNNDYNRDMNIMYDMASTESFTVYDINNEVNTILMDNKGLGVRLATISFITELGKRCMNPVETIKMFTLLSHTICDDCFIDYITDI
SPPDNTIPNISTREYLKLIGITAIMFATYKTLKYMIG
237
Not Available
Not Available
01-11-1996
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host apoptosis. Interacts with host BAX and thereby inhibits its activity.
Not Available
Not Available
Not Available
Not Available
X-ray crystallography (2)
5AJJ  5AJK  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available