viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF3[Gene ID: 1491971 ]
Protein VP2 (Minor capsid protein)
Norwalk Virus (strain GI/Human/United States/Norwalk/1968) (Hu/NV/NV/1968/US)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Caliciviridae> Norovirus> Norwalk Virus> Norovirus Isolates> Norwalk Virus (strain GI/Human/United States/Norwalk/1968) (Hu/NV/NV/1968/US)
Various pathway(s) in which protein is involved
Not Available
MAQAIIGAIAASTAGSALGAGIQVGGEAALQSQRYQQNLQLQENSFKHDREMIGYQVEASNQLLAKNLATRYSLLRAGGLTSADAARSVAGAPVTRIVDW
NGVRVSAPESSATTLRSGGFMSVPIPFASKQKQVQSSGISNPNYSPSSISRTTSWVESQNSSRFGNLSPYHAEALNTVWLTPPGSTASSTLSSVPRGYFN
TDRLPLFANNRR
212
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Minor structural protein present in one or two copies per virion. Stabilizes capsid protein VP1 by protecting it from disassembly and degradation. May play a role in RNA genome packaging.
Not Available
Virion . Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available