viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF2[Gene ID: 1491972 ]
Capsid protein VP1 (CP) (p59) [Cleaved into: Soluble capsid protein (Protein 30k) (p30)]
Norwalk Virus (strain GI/Human/United States/Norwalk/1968) (Hu/NV/NV/1968/US)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Caliciviridae> Norovirus> Norwalk Virus> Norovirus Isolates> Norwalk Virus (strain GI/Human/United States/Norwalk/1968) (Hu/NV/NV/1968/US)
Various pathway(s) in which protein is involved
Not Available
MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDPVAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTISPNNTPGDVLFDLSLGPHLNPFLLHLSQMY
NGWVGNMRVRIMLAGNAFTAGKIIVSCIPPGFGSHNLTIAQATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDRNQQTMRLVCMLYTPLRTGGGTGDSF
VVAGRVMTCPSPDFNFLFLVPPTVEQKTRPFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVIN
LTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSIT
EATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGV
FVFVSWVSRFYQLKPVGTASSARGRLGLRR
530
Not Available
Not Available
11-07-2006
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assembled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.
♦ Soluble capsid protein may play a role in viral immunoevasion.
Not Available
Virion. Host cytoplasm.
Not Available
Not Available
X-ray crystallography (9)
1IHM  2ZL5  2ZL6  2ZL7  3BY1  3BY2  3D26  5KW9  5N7M  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available