viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 1 (NSP1) (NCVP2) (Non-structural RNA-binding protein 53) (NS53)
Rotavirus A (strain RVA/Human/United Kingdom/ST3/1975/G4P2A[6]) (RV-A) (Rotavirus A (strain St. Thomas 3))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G4> Rotavirus A (strain RVA/Human/United Kingdom/ST3/1975/G4P2A[6]) (RV-A) (Rotavirus A (strain St. Thomas 3))
Various pathway(s) in which protein is involved
Not Available
Not Available
MATFKDACYYYKRINKLNHVVLKLGVNDTWRPSPPTKYKGWCLDCCQHTDLTYCQGCTMYHDCQWCSQYGRCFLDSEPHLLRMRTFKNEVTKNDLMNLID
MYNTLFPINQKIVDKFINSTRQHKCRNECMTQWYNHLLMPITLQSLSIELDGDVYYVFGYYDSMSDINQTPFSFANLIDIYDKLLLDNINFNRMSFLPVA
LQQEYALRYFSKSRFISEKRKCVSDLHFSANVIENLHNPSFKIQITRNCIELSSDWNGACKLVEDVSAYFDMLKTSHIEFYSISTRCRVFTQHKLKMASK
HIKPNYVTSNHRTSATEVHNCKWCSINNSYAVWNDFRVKKIYDNIFNFLRALVKSNANVGHCSSQEKIYEHIEDVLDVCDDEKWKTAVTEIFNCLEPVEL
DAVKYVLFNHEVNWDVINLLVQSVGKVPQILTLNDIVIIMKSIIYEWFDIRYMRNTPMTTFTVDKLRQLCTGVKTVDYDSGISDVE
486
Not Available
Not Available
01-11-1996
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host innate immunity by inducing the degradation of key host factors required to activate interferon production such as IRF3, IRF5 or IRF7. Associates with components of cullin RING ligases (CRLs) including CUL1 or CUL3, which are essential multisubunit ubiquitination complexes, to modulate their activities. Recognizes the host NF-kappa-B regulator BTRC through the presence of a DSGXS motif in the C-terminal substrate recognition domain.
Not Available
GO:0003723  ;   GO:0030430  ;   GO:0039548  ;   GO:0039557  ;   GO:0039644  ;  
GO:0044163  ;   GO:0046872  
Host cytoplasm, host cytoskeleton .
Not Available
MOTIF 479 483 IKBKB-like degron (ILD) motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available