Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E2[Gene ID: 1497435 ]
Regulatory protein E2
Human Papillomavirus Type 54
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 13> Human Papillomavirus Type 54
Various pathway(s) in which protein is involved
Not Available
METLATRLDVCQERLLDLYEKDSNKLEDQIEHWKCIRLECALQYKAREMGYKVLQHQALPALAVSKGKGHKAIELQLALETLQKTVYSTEPWTLQDTCLE
RWNAPPTGCLKRRGQTVDVIFDGHQDNTMQYVMWGDIYYQNCDGEGWTKVCSNIDAMGIYYMDAEHKVYYVDFKKEASKYGEYGQWEVRMGSSIIFSPAS
VSSTEEALSISSTGTAEHTRPANSTPRTDNSTKAIPCTPPPRKRARVYSTDQQPHSTSDPVGCDNDRHISDDNNKNQGRHTSSGDTTPIVHFKGEPNTLK
CFRQRIQKYKHLFEQASSTWHWACVPGTTKNRGIVTLTYSSVEQRQQFLVTVRIPPSISMSLGVMSL
RWNAPPTGCLKRRGQTVDVIFDGHQDNTMQYVMWGDIYYQNCDGEGWTKVCSNIDAMGIYYMDAEHKVYYVDFKKEASKYGEYGQWEVRMGSSIIFSPAS
VSSTEEALSISSTGTAEHTRPANSTPRTDNSTKAIPCTPPPRKRARVYSTDQQPHSTSDPVGCDNDRHISDDNNKNQGRHTSSGDTTPIVHFKGEPNTLK
CFRQRIQKYKHLFEQASSTWHWACVPGTTKNRGIVTLTYSSVEQRQQFLVTVRIPPSISMSLGVMSL
367
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in the initiation of viral DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex.
Not Available
Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available