viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Pan Troglodytes (Chimpanzee) [TaxID: 9598]
X
Protein X (HBx) (Peptide X) (pX)
Hepatitis B Virus Genotype E (isolate Cote D'Ivoire/ABI-212/2003) (HBV-E)
Viruses> Retro-transcribing Viruses> Hepadnaviridae> Orthohepadnavirus (mammalian Hepatitis B-type Viruses)> Hepatitis B Virus (HBV)> HBV Genotype E> Hepatitis B Virus Genotype E (isolate Cote D'Ivoire/ABI-212/2003) (HBV-E)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
154
Not Available
Not Available
01-06-2003
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Multifunctional protein that plays a role in silencing host antiviral defenses and promoting viral transcription. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding host CFLAR, a key regulator of the death-inducing signaling complex (DISC). Promotes viral transcription by using the host E3 ubiquitin ligase DDB1 to target the SMC5-SMC6 complex to proteasomal degradation. This host complex would otherwise bind to viral episomal DNA, and prevents its transcription. Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT.
Not Available
GO:0006351  ;   GO:0006355  ;   GO:0019079  ;   GO:0033650  ;   GO:0039592  ;  
GO:0039652  ;   GO:0042025  
Host cytoplasm . Host nucleus . Host mitochondrion . Note=Mainly cytoplasmic as only a fraction is detected in the nucleus. In cytoplasm, a minor fraction associates with mitochondria or proteasomes. .
Not Available
Not Available
X-ray crystallography (1)
3I7H  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available