viHumans
Reviewed
Bos Taurus (Bovine) [TaxID: 9913]; Felis Catus (Cat) (Felis Silvestris Catus) [TaxID: 9685]; Homo Sapiens (Human) [TaxID: 9606]; Loxodonta Africana (African Elephant) [TaxID: 9785]; Microtus Agrestis (Short-tailed Field Vole) [TaxID: 29092]; Mus Musculus (Mouse) [TaxID: 10090]; Myodes Glareolus (Bank Vole) (Clethrionomys Glareolus) [TaxID: 447135]
A48R
Cu-Zn superoxide dismutase-like protein
Cowpox Virus (strain GRI-90 / Grishak) (CPV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Cowpox Virus (CPV)> Cowpox Virus (strain GRI-90 / Grishak) (CPV)
 
Various pathway(s) in which protein is involved
Not Available
Not Available
MAVCIIDHDNIRGVIYFEPVHGKDKVLGSVIGLKSGTYSLIIHRYGDISRGCDSIGSPEIFIGNIFVNRYGVAYVYLDTDVNISTIIGKALSISKNDQRL
ACGVIGISYINEKIIHFLTINENGV
125
Not Available
Not Available
01-06-2003
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Virion protein with no enzymatic activity.
Not Available
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available