viHumans
Reviewed
Aves [TaxID: 8782]; Felis Catus (Cat) (Felis Silvestris Catus) [TaxID: 9685]; Homo Sapiens (Human) [TaxID: 9606]; Panthera Pardus (Leopard) (Felis Pardus) [TaxID: 9691]; Panthera Tigris (Tiger) [TaxID: 9694]; Sus Scrofa (Pig) [TaxID: 9823]
PB1
RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) (Fragment)
Influenza A Virus (strain A/Chicken/Hong Kong/FY150/2001 H5N1 Genotype D)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H5N1 Subtype> Influenza A Virus (strain A/Chicken/Hong Kong/FY150/2001 H5N1 Genotype D)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEKSHP
GIFENSCLETMEIVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANESGRLIDFLKDVMESMDKGEMEITTHFQRKRRVRDNMTKKMV
TQRTIGKKKQRLNKRSYLIRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSF
TITGDNTKWNENQNPRMFLAMITYITRKQPEWFRNVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLASIDLKYFNESTRKKIEKIRPLLIDGT
ASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTFEFTS
494
Not Available
Not Available
01-06-2003
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
RNA-dependent RNA polymerase which is responsible for replication and transcription of virus RNA segments. The transcription of viral mRNAs occurs by a unique mechanism called cap-snatching. 5' methylated caps of cellular mRNAs are cleaved after 10-13 nucleotides by PA. In turn, these short capped RNAs are used as primers by PB1 for transcription of viral mRNAs. During virus replication, PB1 initiates RNA synthesis and copy vRNA into complementary RNA (cRNA) which in turn serves as a template for the production of more vRNAs.
2.7.7.48  
GO:0000166  ;   GO:0003723  ;   GO:0003968  ;   GO:0019083  ;   GO:0030430  ;  
GO:0039523  ;   GO:0039694  ;   GO:0042025  
Host nucleus . Host cytoplasm .
DOMAIN 286 483 RdRp catalytic.
MOTIF 187 195 Nuclear localization signal. ; MOTIF 203 216 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available