viHumans
Reviewed
Aves [TaxID: 8782]; Felis Catus (Cat) (Felis Silvestris Catus) [TaxID: 9685]; Homo Sapiens (Human) [TaxID: 9606]; Panthera Pardus (Leopard) (Felis Pardus) [TaxID: 9691]; Panthera Tigris (Tiger) [TaxID: 9694]; Sus Scrofa (Pig) [TaxID: 9823]
PA
Polymerase acidic protein (RNA-directed RNA polymerase subunit P2) (Fragment)
Influenza A Virus (strain A/Chicken/Hong Kong/FY150/2001 H5N1 Genotype D)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H5N1 Subtype> Influenza A Virus (strain A/Chicken/Hong Kong/FY150/2001 H5N1 Genotype D)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
DDFQLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRTAVGQVSRPMFLYVRTNGTSKIKMKW
GMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIAQALRDNLE
PGPSILEGYMKQLRSA
216
Not Available
Not Available
01-06-2003
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Implicated in endonuclease cleavage of capped RNA primers. Displays an elongation factor activity in viral RNA synthesis. Dispensable for viral transcription, but not replication (By similarity).
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available