Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Macaca Fascicularis (Crab-eating Macaque) (Cynomolgus Monkey) [TaxID: 9541]; Macaca Leonina (Northern Pig-tailed Macaque) (Macaca Nemestrina Leonina) [TaxID: 90387]; Macaca Mulatta (Rhesus Macaque) [TaxID: 9544]; Macaca Nemestrina (Pig-tailed Macaque) [TaxID: 9545]
US12[Gene ID: 3850189 ]
ICP47 protein (Immediate-early protein IE12) (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)
Cercopithecine Herpesvirus 16 (CeHV-16) (Herpesvirus Papio 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Cercopithecine Herpesvirus 16 (CeHV-16) (Herpesvirus Papio 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSSLYLAEVDAFLQSPRTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPDRSRPAPRGTAHPPAASP
78
Not Available
Not Available
01-10-2003
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing (TAP), thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecules. Empty MHC I molecules are retained in the endoplasmic reticulum and ultimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.
Not Available
Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available