viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Paguma Larvata (Masked Palm Civet) [TaxID: 9675]
7b[Gene ID: 1489675 ]
Protein non-structural 7b (ns7b) (Accessory protein 7b)
Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Severe Acute Respiratory Syndrome-related Coronavirus> Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Various pathway(s) in which protein is involved
Not Available
MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV
44
Not Available
Not Available
01-10-2003
Predicted
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
♦ Host membrane
♦ Single-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available