Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF63; ORF70[Gene ID: 1487700;1487711 ]
Transcriptional regulator ICP22 homolog (Immediate-early protein 63) (IE63) (Transcriptional transactivator IE63)
Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MFCTSPATRGDSSESKPGASVDVNGKMEYGSAPGPLNGRDTSRGPGAFCTPGWEIHPARLVEDINRVFLCIAQSSGRVTRDSRRLRRICLDFYLMGRTRQ
RPTLACWEELLQLQPTQTQCLRATLMEVSHRPPRGEDGFIEAPNVPLHRSALECDVSDDGGEDDSDDDGSTPSDVIEFRDSDAESSDGEDFIVEEESEES
TDSCEPDGVPGDCYRDGDGCNTPSPKRPQRAIERYAGAETAEYTAAKALTALGEGGVDWKRRRHEAPRRHDIPPPHGV
RPTLACWEELLQLQPTQTQCLRATLMEVSHRPPRGEDGFIEAPNVPLHRSALECDVSDDGGEDDSDDDGSTPSDVIEFRDSDAESSDGEDFIVEEESEES
TDSCEPDGVPGDCYRDGDGCNTPSPKRPQRAIERYAGAETAEYTAAKALTALGEGGVDWKRRRHEAPRRHDIPPPHGV
278
Not Available
Not Available
05-07-2004
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Immediate early (EI) protein that functions as a transcriptional regulator of cellular and viral mRNAs mainly by interacting with several general transcription factors thereby disorganizing the preinitiation complex at certain promoters. May additionally help to regulate levels of histones in virus-infected cells by interacting with host ASF1. By inhibiting host transcriptional program, IE63 plays a major role in the ability of VZV to overcome the innate immune response to the virus (By similarity).
Not Available
Host cytoplasm. Host nucleus. Virion tegument. Note=During the first stage of infection, IE63 is mostly expressed in the nucleus and also slightly in the cytoplasm, and during latency, IE63 localizes in the cytoplasm quite exclusively.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available