Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Vpx
Protein Vpx (Viral protein X) (X ORF protein)
Human Immunodeficiency Virus Type 2 Subtype B (isolate UC1) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> HIV-2 Subtype B> Human Immunodeficiency Virus Type 2 Subtype B (isolate UC1) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDPRERVPPGNSDEETIGEAFDWLERTITELNRVAVNHLPRELIFQVWQRCWAYWREEQGMSSSYTKYRYLLLMQKAMFVHYTKGCRCLQEGHGPGGWRS
GPPPPPPPGLA
GPPPPPPPGLA
111
Not Available
Not Available
01-11-1996
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription (By similarity).
Not Available
Virion. Host nucleus. Note=Nuclear just after virion uncoating, or if expressed in the absence of unprocessed GAG. .
Not Available
MOTIF 64 71 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available