Reviewed
Homo Sapiens (Human) [TaxID: 9606]
M2[Gene ID: 2799940 ]
Matrix protein M2-2
Human Metapneumovirus (strain CAN97-83) (HMPV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Metapneumovirus> Human Metapneumovirus> Human Metapneumovirus (strain CAN97-83) (HMPV)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MTLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
71
Not Available
Not Available
05-07-2004
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Mediates the regulatory switch from transcription to RNA replication. Acts late in infection by inhibiting viral transcription and up-regulating RNA replication (By similarity). Plays a major role in antagonizing the type I IFN-mediated antiviral response. Interacts with host MAVS and prevents the interaction with its upstream partner DDX58/RIG-I in the signaling pathway leading to interferon production.
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available