Reviewed
Homo Sapiens (Human) [TaxID: 9606]
SH[Gene ID: 2799941 ]
Small hydrophobic protein
Human Metapneumovirus (strain CAN97-83) (HMPV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Metapneumovirus> Human Metapneumovirus> Human Metapneumovirus (strain CAN97-83) (HMPV)
Not Available
Various pathway(s) in which protein is involved
Not Available
MITLDVIKSDGSSKTCTHLKKIIKDHSGKVLIALKLILALLTFFTITITINYIKVENNLQICQSKTESDKEDSPSNTTSVTTKTTLDHDITQYFKRLIQR
YTDSVINKDTCWKISRNQCTNITTYKFLCFKPEDSKINSCDRLTDLCRNKSKSAAEAYHTVECHCIYTIEWKCYHHSID
YTDSVINKDTCWKISRNQCTNITTYKFLCFKPEDSKINSCDRLTDLCRNKSKSAAEAYHTVECHCIYTIEWKCYHHSID
179
Not Available
Not Available
05-07-2004
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
May form a proton-selective ion channel, playing a role in budding and /or during virus entry. May also play a role in counteracting host innate immunity (By similarity).
Not Available
♦ Virion membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein .
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available