viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
G[Gene ID: 2799942 ]
Major surface glycoprotein G (Attachment glycoprotein G) (Membrane-bound glycoprotein) (mG)
Human Metapneumovirus (strain CAN97-83) (HMPV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Metapneumovirus> Human Metapneumovirus> Human Metapneumovirus (strain CAN97-83) (HMPV)
Not Available
Various pathway(s) in which protein is involved
Not Available
MEVKVENIRAIDMLKARVKNRVARSKCFKNASLILIGITTLSIALNIYLIINYTIQKTSSESEHHTSSPPTESNKEASTISTDNPDINPNSQHPTQQSTE
NPTLNPAASVSPSETEPASTPDTTNRLSSVDRSTAQPSESRTKTKPTVHTRNNPSTASSTQSPPRATTKAIRRATTFRMSSTGKRPTTTSVQSDSSTTTQ
NHEETGSANPQASVSTMQN
219
Not Available
Not Available
05-07-2004
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Attaches the virion to the host cell membrane by interacting with glycosaminoglycans, initiating the infection. Unlike other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities. In addition to its role in attachment, glycoprotein G interacts with host DDX58 and inhibits DDX58-mediated signaling pathway in order to prevent the establishment of the antiviral state.
Not Available
GO:0016021  ;   GO:0019012  ;   GO:0019062  ;   GO:0033644  ;   GO:0039540  ;  
GO:0046718  
♦ Host membrane
♦ Single-pass type I membrane protein . Virion.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available