Reviewed
Erythrocebus Patas (Red Guenon) (Cercopithecus Patas) [TaxID: 9538]; Homo Sapiens (Human) [TaxID: 9606]; Macaca (macaques) [TaxID: 9539]; Papio Hamadryas (Hamadryas Baboon) [TaxID: 9557]
LAP 5L[Gene ID: 2943673 ]
E3 ubiquitin-protein ligase LAP (EC 2.3.2.27) (Leukemia associated protein) (LAP) (RING-type E3 ubiquitin transferase)
Yaba Monkey Tumor Virus (strain VR587) (YMTV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Yatapoxvirus> Yaba Monkey Tumor Virus (YMTV)> Yaba Monkey Tumor Virus (strain VR587) (YMTV)
Various pathway(s) in which protein is involved
Not Available
MSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHYFSRWKWCFSDKKTVLSKILFIFFAVGFIFITTSMSSNVAS
LVTRIDDTFFDVVFLTVYISMILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV
LVTRIDDTFFDVVFLTVYISMILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV
156
Not Available
Not Available
05-07-2004
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
E3 ubiquitin-protein ligase which promotes ubiquitination and subsequent degradation of host MHC-I and CD4 molecules, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell. Binds target molecules through transmembrane interaction. The result of this ubiquitination is the enhancement of the endocytosis of the target chain and the delivery to the lysosome, where it is proteolytically destroyed.
2.3.2.27
GO:0008270 ; GO:0016021 ; GO:0016740 ; GO:0033644 ; GO:0039504 ;
GO:0039648 ; GO:0044174 ; GO:0044177 ; GO:0046776
GO:0039648 ; GO:0044174 ; GO:0044177 ; GO:0046776
♦ Host membrane
♦ Multi-pass membrane protein . Host Golgi apparatus, host trans-Golgi network membrane. Host early endosome membrane .
♦ Multi-pass membrane protein . Host Golgi apparatus, host trans-Golgi network membrane. Host early endosome membrane .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available