Reviewed
Erythrocebus Patas (Red Guenon) (Cercopithecus Patas) [TaxID: 9538]; Homo Sapiens (Human) [TaxID: 9606]; Macaca (macaques) [TaxID: 9539]; Papio Hamadryas (Hamadryas Baboon) [TaxID: 9557]
DUT 17L[Gene ID: 2943676 ]
Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (EC 3.6.1.23) (dUTP pyrophosphatase)
Yaba Monkey Tumor Virus (strain VR587) (YMTV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Yatapoxvirus> Yaba Monkey Tumor Virus (YMTV)> Yaba Monkey Tumor Virus (strain VR587) (YMTV)
Various pathway(s) in which protein is involved
Not Available
MSKFIVYVKKSSEFATIPTRSSKKSAGYDLYSAYDYLVRPKSRVLVKTDICLSIPDECYGRIASRSGLSLNNSIDIGGGVIDGDYRGVIGVIFINNGNSP
HYIKRGDRIAQIVFERLANVEIKEISNLDCTCRGDCGFGSSGI
HYIKRGDRIAQIVFERLANVEIKEISNLDCTCRGDCGFGSSGI
143
Not Available
Not Available
05-07-2004
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.
3.6.1.23
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available