Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL37[Gene ID: 3077462 ]
UL37 immediate early glycoprotein
Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKKACALTRRSRHRLRRQHGVIDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEER
EDEEEENEARTPEVNPMDAEGLSGLAREACEALKKALRRHRFLWQRRRRARLLQHNGPQQSHHAAVFCRVHGLRGFQVSVWLLLTLFWSTGYGVSVRCTY
HGTDINVTSNATSMNCRLNCTCNHTQIYNGPCAGAESKLPLNVTFRQSRRQWHSVMLTFGFQYHLEGWFPLRILNESRDINVTEVYGEVACFTNDTNITM
GQLTLNLTGRSYVLRALARTSPFESSVNWEETNVTDNATSSENNTVTVMSVLTVYAESDYIFLQDMCPRFLKRSVKLAKNNRRNTTFTGTNVTSLPEWTL
QQCQGWKYWTTLSIMWKNRRSALLRAKSRALGHWALLSICTVAAGSIALLSLFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHWIV
EDEEEENEARTPEVNPMDAEGLSGLAREACEALKKALRRHRFLWQRRRRARLLQHNGPQQSHHAAVFCRVHGLRGFQVSVWLLLTLFWSTGYGVSVRCTY
HGTDINVTSNATSMNCRLNCTCNHTQIYNGPCAGAESKLPLNVTFRQSRRQWHSVMLTFGFQYHLEGWFPLRILNESRDINVTEVYGEVACFTNDTNITM
GQLTLNLTGRSYVLRALARTSPFESSVNWEETNVTDNATSSENNTVTVMSVLTVYAESDYIFLQDMCPRFLKRSVKLAKNNRRNTTFTGTNVTSLPEWTL
QQCQGWKYWTTLSIMWKNRRSALLRAKSRALGHWALLSICTVAAGSIALLSLFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHWIV
488
VAR_SEQ 163 163 H -> Q (in isoform vMIA) ; VAR_SEQ 164 487 Missing (in isoform vMIA) ; VAR_SEQ 178 262 Missing (in isoform pUL37m)
Not Available
05-07-2004
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Isoform vMIA sequesters proapoptotic BAX at the outer mitochondrial membrane and prevents cytochrome c release and subsequent initiation of the proapoptotic cascade. Also provoques a calcium efflux from host endoplasmic reticulum and F-actin cytoskeleton disruption. Participates in the increase of host mitochondrial biogenesis, thus promoting viral replication by efficient use of newly made mitochondria (By similarity).
♦ Isoform gpUL37 may play a role in escape from the host antiviral response.
♦ Isoform gpUL37 may play a role in escape from the host antiviral response.
Not Available
♦ Isoform gpUL37: Host membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Host Golgi apparatus membrane
♦ Single-pass membrane protein . Host mitochondrion membrane
♦ Single-pass membrane protein . Note=The C-terminal fragment localizes to the endoplasmic reticulum while the N-terminal fragment is stable and traffics to mitochondria. .
♦ Isoform vMIA: Host mitochondrion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Note=Transported from the endoplasmic reticulum (ER) through the mitochondrial associated membrane (MAMs) to the mitochondrial outer membrane. Associates with internal lipid rafts (LRs) in the MAM (By similarity). .
♦ Isoform pUL37m: Host mitochondrion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Note=Not cleaved or N-glycosylated. .
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Host Golgi apparatus membrane
♦ Single-pass membrane protein . Host mitochondrion membrane
♦ Single-pass membrane protein . Note=The C-terminal fragment localizes to the endoplasmic reticulum while the N-terminal fragment is stable and traffics to mitochondria. .
♦ Isoform vMIA: Host mitochondrion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Note=Transported from the endoplasmic reticulum (ER) through the mitochondrial associated membrane (MAMs) to the mitochondrial outer membrane. Associates with internal lipid rafts (LRs) in the MAM (By similarity). .
♦ Isoform pUL37m: Host mitochondrion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Note=Not cleaved or N-glycosylated. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available