Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL40[Gene ID: 3077540 ]
Protein UL40
Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MNKFSNTRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPVETTVTTAGVTSAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPA
DNTLLIEVGNNTRRHVDGISCQDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFY
SQIARSLGVLPNDHHYALKKA
DNTLLIEVGNNTRRHVDGISCQDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFY
SQIARSLGVLPNDHHYALKKA
221
Not Available
Not Available
05-07-2004
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in the protection against host NK cell cytotoxicity by upregulating the cell surface expression of HLA-E independent of TAP (HLA-E has an inhibitory effect on the cytotoxic activity of the NK cell). Promotes also cell surface expression of UL18, another viral protein involved in NK cell evasion (By similarity).
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available