viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL83[Gene ID: 3077579 ]
65 kDa phosphoprotein (pp65) (65 kDa matrix phosphoprotein) (Phosphoprotein UL83) (Tegument protein UL83)
Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQTGIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGR
SICPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQARLTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVC
AHELVCSMENTRATKMQVIGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLCPKNMIIKPGKISHIMLDVAFTSHE
HFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVW
TSGSDSDEELVTTERKTPRVTGGGAMASASTSAGRKRKSASSATACTAGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMV
ATVQGQNLKYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQDALPGPCIASTPKKHRG
561
Not Available
Not Available
05-07-2004
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Counteracts the host antiviral immune response by preventing IRF3 from entering the nucleus once activated and phosphorylated. Participates also in the transactivation of viral major immediate-early genes by recruiting host IFI16 to their promoters.
Not Available
GO:0009405  ;   GO:0019033  ;   GO:0030430  ;   GO:0039548  ;   GO:0042025  
Virion tegument . Host nucleus . Host cytoplasm . Note=As part of the incoming virion, pp65 is targeted to the nucleus immediately after infection. The newly synthesized pp65 is observed in the nucleus until some time after 48 hours postinfection. Thereafter, pp65 is probably exported and accumulates in the cytoplasm. Also found in dense bodies. .
Not Available
MOTIF 537 560 Bipartite nuclear localization signal.
X-ray crystallography (5)
3MR9  3MRB  3MRC  3MRD  3VCL  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available