viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
M 5[Gene ID: 2943503 ]
Membrane protein (M protein) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)
Human Coronavirus NL63 (HCoV-NL63)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Alphacoronavirus> Human Coronavirus NL63 (HCoV-NL63)
Various pathway(s) in which protein is involved
Not Available
MSNSSVPLLEVYVHLRNWNFSWNLILTLFIVVLQYGHYKYSRLLYGLKMSVLWCLWPLVLALSIFDCFVNFNVDWVFFGFSILMSIITLCLWVMYFVNSF
RLWRRVKTFWAFNPETNAIISLQVYGHNYYLPVMAAPTGVTLTLLSGVLLVDGHKIATRVQVGQLPKYVIVATPSTTIVCDRVGRSVNETSQTGWAFYVR
AKHGDFSGVASQEGVLSEREKLLHLI
226
Not Available
Not Available
05-07-2004
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0019058  ;   GO:0039660  ;   GO:0044178  ;  
GO:0055036  
♦ Virion membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Note=Largely embedded in the lipid bilayer. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available